![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H2A [47115] (7 species) |
![]() | Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (6 PDB entries) Uniprot P02263 |
![]() | Domain d1hioa_: 1hio A: [16439] Other proteins in same PDB: d1hiob_, d1hioc_, d1hiod_ |
PDB Entry: 1hio (more details), 3.1 Å
SCOPe Domain Sequences for d1hioa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hioa_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} ksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk ktriiprhlqlairndeelnkllgkvtiaqggvlp
Timeline for d1hioa_: