PDB entry 1hio

View 1hio on RCSB PDB site
Description: histone octamer (chicken), chromosomal protein, alpha carbons only
Class: chromosomal protein
Keywords: histone, chromosomal protein, nucleosome core
Deposited on 1991-09-19, released 1998-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.255
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone h2a
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hioa_
  • Chain 'B':
    Compound: histone h2b
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02279 (0-89)
      • conflict (25)
      • conflict (40)
      • conflict (85)
    Domains in SCOPe 2.08: d1hiob_
  • Chain 'C':
    Compound: histone h3
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84229 (0-92)
      • conflict (82)
    Domains in SCOPe 2.08: d1hioc_
  • Chain 'D':
    Compound: histone h4
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hiod_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hioA (A:)
    ksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
    ktriiprhlqlairndeelnkllgkvtiaqggvlp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hioB (B:)
    sysiyvykvlkqvhpdtgisskamgsmnsfvndiferiaglasrlahynkrstitsreiq
    tavrlllpgelakhavsegtkavtkhtssk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hioC (C:)
    pgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvg
    lfedtnlcaihakrvtimpkdielarrirgera
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hioD (D:)
    qgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtamdv
    vyalkrqgrtlygfgg