Lineage for d1hioa_ (1hio A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151058Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 151059Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 151060Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 151061Protein Histone H2A [47115] (4 species)
  7. 151068Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (4 PDB entries)
  8. 151074Domain d1hioa_: 1hio A: [16439]
    Other proteins in same PDB: d1hiob_, d1hioc_, d1hiod_

Details for d1hioa_

PDB Entry: 1hio (more details), 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein, alpha carbons only

SCOP Domain Sequences for d1hioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hioa_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes}
ksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
ktriiprhlqlairndeelnkllgkvtiaqggvlp

SCOP Domain Coordinates for d1hioa_:

Click to download the PDB-style file with coordinates for d1hioa_.
(The format of our PDB-style files is described here.)

Timeline for d1hioa_: