Lineage for d1hmf__ (1hmf -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2075Fold a.21: HMG-box [47094] (1 superfamily)
  4. 2076Superfamily a.21.1: HMG-box [47095] (1 family) (S)
  5. 2077Family a.21.1.1: HMG-box [47096] (7 proteins)
  6. 2083Protein HMG1, domains A and B [47097] (2 species)
  7. 2089Species Rat (Rattus norvegicus) [TaxId:10116] [47098] (4 PDB entries)
  8. 2093Domain d1hmf__: 1hmf - [16419]

Details for d1hmf__

PDB Entry: 1hmf (more details)

PDB Description: structure of the hmg box motif in the b-domain of hmg1

SCOP Domain Sequences for d1hmf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hmf__ a.21.1.1 (-) HMG1, domains A and B {Rat (Rattus norvegicus)}
fkdpnapkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekka
aklkekyekdiaayrak

SCOP Domain Coordinates for d1hmf__:

Click to download the PDB-style file with coordinates for d1hmf__.
(The format of our PDB-style files is described here.)

Timeline for d1hmf__: