SCOPe 2.08: Domain d1hmfa_: 1hmf A:

Lineage for d1hmfa_ (1hmf A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.1: HMG-box [47096] (10 proteins)

6. Protein High mobility group protein 1, HMG1 [47097] (2 species)
   duplication: contains HMG-box domains

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47098] (4 PDB entries)

8. Domain d1hmfa_: 1hmf A: [16419]
   domain B

Details for d1hmfa_

PDB Entry: 1hmf

PDB Description: structure of the hmg box motif in the b-domain of hmg1

PDB Compounds: (A:) high mobility group protein fragment-b

SCOPe Domain Sequences for d1hmfa_:

Sequence; same for both SEQRES and ATOM records:

>d1hmfa_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fkdpnapkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekka
aklkekyekdiaayrak

Timeline for d1hmfa_:

• d1hmfa_ first appeared (with stable ids) in SCOP 1.55, called d1hmf__
  
• d1hmfa_ appears in SCOPe 2.07