Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore |
Protein automated matches [190531] (8 species) not a true protein |
Species Red algae (Gracilaria chilensis) [TaxId:2775] [187492] (1 PDB entry) |
Domain d2bv8n_: 2bv8 N: [163181] automated match to d1phnb_ complexed with cyc, peb |
PDB Entry: 2bv8 (more details), 2.01 Å
SCOPe Domain Sequences for d2bv8n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bv8n_ a.1.1.3 (N:) automated matches {Red algae (Gracilaria chilensis) [TaxId: 2775]} mldafakvvaqadargeflsntqldalanmiaegnkrldivnrinsnasaivsnsaralf aeqpqliqpggnaytnrrmaaclrdmeivlryvsyaeiagdssvlddrclnglretyqal gtpgssvavaiekmkeasvsdandssgtpsgdcsslsaelgtyfdraasavs
Timeline for d2bv8n_: