Lineage for d2bv8l_ (2bv8 L:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1077042Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 1077200Protein automated matches [190531] (8 species)
    not a true protein
  7. 1077235Species Red algae (Gracilaria chilensis) [TaxId:2775] [187492] (1 PDB entry)
  8. 1077243Domain d2bv8l_: 2bv8 L: [163179]
    automated match to d1phnb_
    complexed with cyc, peb

Details for d2bv8l_

PDB Entry: 2bv8 (more details), 2.01 Å

PDB Description: the crystal structure of phycocyanin from gracilaria chilensis.
PDB Compounds: (L:) c-phycocyanin beta subunit

SCOPe Domain Sequences for d2bv8l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bv8l_ a.1.1.3 (L:) automated matches {Red algae (Gracilaria chilensis) [TaxId: 2775]}
mldafakvvaqadargeflsntqldalanmiaegnkrldivnrinsnasaivsnsaralf
aeqpqliqpggnaytnrrmaaclrdmeivlryvsyaeiagdssvlddrclnglretyqal
gtpgssvavaiekmkeasvsdandssgtpsgdcsslsaelgtyfdraasavs

SCOPe Domain Coordinates for d2bv8l_:

Click to download the PDB-style file with coordinates for d2bv8l_.
(The format of our PDB-style files is described here.)

Timeline for d2bv8l_: