![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (26 proteins) |
![]() | Protein automated matches [190264] (12 species) not a true protein |
![]() | Species Jacaratia mexicana [TaxId:309130] [187452] (1 PDB entry) |
![]() | Domain d2bdzc_: 2bdz C: [163050] automated match to d1yala_ complexed with e64 |
PDB Entry: 2bdz (more details), 2.1 Å
SCOPe Domain Sequences for d2bdzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bdzc_ d.3.1.1 (C:) automated matches {Jacaratia mexicana [TaxId: 309130]} ypesidwrekgavtpvknqnpcgscwafstvatieginkiitgqlislseqelldcerrs hgcdggyqttslqyvvdngvhtereypyekkqgrcrakdkkgpkvyitgykyvpandeis liqaianqpvsvvtdsrgrgfqfykggiyegpcgtntdhavtavgygktylllknswgpn wgekgyirikrasgrskgtcgvytssffpikg
Timeline for d2bdzc_: