Lineage for d2bdzb_ (2bdz B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926957Protein automated matches [190264] (12 species)
    not a true protein
  7. 2926994Species Jacaratia mexicana [TaxId:309130] [187452] (1 PDB entry)
  8. 2926996Domain d2bdzb_: 2bdz B: [163049]
    automated match to d1yala_
    complexed with e64

Details for d2bdzb_

PDB Entry: 2bdz (more details), 2.1 Å

PDB Description: mexicain from jacaratia mexicana
PDB Compounds: (B:) Mexicain

SCOPe Domain Sequences for d2bdzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bdzb_ d.3.1.1 (B:) automated matches {Jacaratia mexicana [TaxId: 309130]}
ypesidwrekgavtpvknqnpcgscwafstvatieginkiitgqlislseqelldcerrs
hgcdggyqttslqyvvdngvhtereypyekkqgrcrakdkkgpkvyitgykyvpandeis
liqaianqpvsvvtdsrgrgfqfykggiyegpcgtntdhavtavgygktylllknswgpn
wgekgyirikrasgrskgtcgvytssffpikg

SCOPe Domain Coordinates for d2bdzb_:

Click to download the PDB-style file with coordinates for d2bdzb_.
(The format of our PDB-style files is described here.)

Timeline for d2bdzb_: