Lineage for d1yala_ (1yal A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926812Protein Chymopapain [54009] (1 species)
  7. 2926813Species Papaya (Carica papaya) [TaxId:3649] [54010] (1 PDB entry)
  8. 2926814Domain d1yala_: 1yal A: [37025]

Details for d1yala_

PDB Entry: 1yal (more details), 1.7 Å

PDB Description: carica papaya chymopapain at 1.7 angstroms resolution
PDB Compounds: (A:) chymopapain

SCOPe Domain Sequences for d1yala_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]}
ypqsidwrakgavtpvknqgacgscwafstiatveginkivtgnllelseqelvdcdkhs
ygckggyqttslqyvanngvhtskvypyqakqykcratdkpgpkvkitgykrvpsncets
flgalanqplsvlveaggkpfqlyksgvfdgpcgtkldhavtavgygtsdgknyiiikns
wgpnwgekgymrlkrqsgnsqgtcgvykssyypfkgfa

SCOPe Domain Coordinates for d1yala_:

Click to download the PDB-style file with coordinates for d1yala_.
(The format of our PDB-style files is described here.)

Timeline for d1yala_: