PDB entry 1yal

View 1yal on RCSB PDB site
Description: carica papaya chymopapain at 1.7 angstroms resolution
Class: hydrolase
Keywords: hydrolase, thiol protease
Deposited on 1996-06-20, released 1996-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.192
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chymopapain
    Species: Carica papaya [TaxId:3649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14080 (0-217)
      • conflict (24)
      • conflict (116)
    Domains in SCOPe 2.07: d1yala_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yalA (A:)
    ypqsidwrakgavtpvknqgacgscwafstiatveginkivtgnllelseqelvdcdkhs
    ygckggyqttslqyvanngvhtskvypyqakqykcratdkpgpkvkitgykrvpsncets
    flgalanqplsvlveaggkpfqlyksgvfdgpcgtkldhavtavgygtsdgknyiiikns
    wgpnwgekgymrlkrqsgnsqgtcgvykssyypfkgfa