Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (2 families) |
Family a.4.10.1: N-terminal Zn binding domain of HIV integrase [46920] (1 protein) Zn-binding site is near the C-terminus |
Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [46922] (8 PDB entries) |
Domain d1wjca_: 1wjc A: [16261] complexed with zn |
PDB Entry: 1wjc (more details)
SCOPe Domain Sequences for d1wjca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wjca_ a.4.10.1 (A:) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 1 [TaxId: 11676]} fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkg
Timeline for d1wjca_: