Lineage for d1wjca_ (1wjc A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984450Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (1 family) (S)
  5. 1984451Family a.4.10.1: N-terminal Zn binding domain of HIV integrase [46920] (1 protein)
    Zn-binding site is near the C-terminus
  6. 1984452Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species)
  7. 1984453Species Human immunodeficiency virus type 1 [TaxId:11676] [46922] (7 PDB entries)
  8. 1984460Domain d1wjca_: 1wjc A: [16261]
    complexed with zn

Details for d1wjca_

PDB Entry: 1wjc (more details)

PDB Description: solution structure of the n-terminal zn binding domain of hiv-1 integrase (e form), nmr, regularized mean structure
PDB Compounds: (A:) hiv-1 integrase

SCOPe Domain Sequences for d1wjca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjca_ a.4.10.1 (A:) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 1 [TaxId: 11676]}
fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkg

SCOPe Domain Coordinates for d1wjca_:

Click to download the PDB-style file with coordinates for d1wjca_.
(The format of our PDB-style files is described here.)

Timeline for d1wjca_: