![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.10: Retroviral integrase, N-terminal Zn binding domain [46919] (3 families) ![]() |
![]() | Family a.4.10.1: HIV/SIV integrase, N-terminal Zn binding domain [46920] (2 proteins) Zn-binding site is near the C-terminus Pfam PF02022 |
![]() | Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [46922] (8 PDB entries) |
![]() | Domain d1wjca_: 1wjc A: [16261] complexed with zn |
PDB Entry: 1wjc (more details)
SCOPe Domain Sequences for d1wjca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wjca_ a.4.10.1 (A:) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 1 [TaxId: 11676]} fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkg
Timeline for d1wjca_: