SCOPe 2.07: Domain d1wjcb_: 1wjc B:

Lineage for d1wjcb_ (1wjc B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (2 families)

5. Family a.4.10.1: N-terminal Zn binding domain of HIV integrase [46920] (1 protein)
   Zn-binding site is near the C-terminus

6. Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [46922] (8 PDB entries)

8. Domain d1wjcb_: 1wjc B: [16262]
   complexed with zn

Details for d1wjcb_

PDB Entry: 1wjc

PDB Description: solution structure of the n-terminal zn binding domain of hiv-1 integrase (e form), nmr, regularized mean structure

PDB Compounds: (B:) hiv-1 integrase

SCOPe Domain Sequences for d1wjcb_:

Sequence; same for both SEQRES and ATOM records:

>d1wjcb_ a.4.10.1 (B:) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 1 [TaxId: 11676]}
fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkg

Timeline for d1wjcb_:

• d1wjcb_ first appeared (with stable ids) in SCOP 1.55
  
• d1wjcb_ appears in SCOPe 2.06
  
• d1wjcb_ appears in the current release, SCOPe 2.08