SCOPe 2.08: Domain d1cf7a_: 1cf7 A:

Lineage for d1cf7a_ (1cf7 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.17: Cell cycle transcription factor e2f-dp [46847] (2 proteins)
   heterodimer of two homologous chains

6. Protein Cell cycle transcription factor E2F-4 [88652] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88653] (1 PDB entry)

8. Domain d1cf7a_: 1cf7 A: [16151]
   Other proteins in same PDB: d1cf7b_
   protein/DNA complex

Details for d1cf7a_

PDB Entry: 1cf7, 2.6 Å

PDB Description: structural basis of dna recognition by the heterodimeric cell cycle transcription factor e2f-dp

PDB Compounds: (A:) protein (transcription factor e2f-4)

SCOPe Domain Sequences for d1cf7a_:

Sequence; same for both SEQRES and ATOM records:

>d1cf7a_ a.4.5.17 (A:) Cell cycle transcription factor E2F-4 {Human (Homo sapiens) [TaxId: 9606]}
srhekslgllttkfvsllqeakdgvldlklaadtlavrqkrriyditnvlegigliekks
knsiqwk

Timeline for d1cf7a_:

• d1cf7a_ first appeared (with stable ids) in SCOP 1.55
  
• d1cf7a_ appears in SCOPe 2.07