Lineage for d1cf7a_ (1cf7 A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) 
Family a.4.5.17: Cell cycle transcription factor e2f-dp [46847] (1 protein) Protein Cell cycle transcription factor e2f-dp [46848] (1 species) Species Human (Homo sapiens) [TaxId:9606] [46849] (1 PDB entry) 
Domain d1cf7a_: 1cf7 A: [16151]
Details for d1cf7a_
PDB Entry: 1cf7 (more details), 2.6 Å
PDB Description: structural basis of dna recognition by the heterodimeric cell cycle transcription factor e2f-dp
SCOP Domain Sequences for d1cf7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cf7a_ a.4.5.17 (A:) Cell cycle transcription factor e2f-dp {Human (Homo sapiens)}
srhekslgllttkfvsllqeakdgvldlklaadtlavrqkrriyditnvlegigliekks
knsiqwk
SCOP Domain Coordinates for d1cf7a_:
Click to download the PDB-style file with coordinates for d1cf7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cf7a_:
- d1cf7a_ appears in SCOP 1.57
- d1cf7a_ appears in the current release, SCOPe 2.08
View in 3D
