Lineage for d1cf7a_ (1cf7 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1562Family a.4.5.17: Cell cycle transcription factor e2f-dp [46847] (1 protein)
  6. 1563Protein Cell cycle transcription factor e2f-dp [46848] (1 species)
  7. 1564Species Human (Homo sapiens) [TaxId:9606] [46849] (1 PDB entry)
  8. 1565Domain d1cf7a_: 1cf7 A: [16151]

Details for d1cf7a_

PDB Entry: 1cf7 (more details), 2.6 Å

PDB Description: structural basis of dna recognition by the heterodimeric cell cycle transcription factor e2f-dp

SCOP Domain Sequences for d1cf7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf7a_ a.4.5.17 (A:) Cell cycle transcription factor e2f-dp {Human (Homo sapiens)}
srhekslgllttkfvsllqeakdgvldlklaadtlavrqkrriyditnvlegigliekks
knsiqwk

SCOP Domain Coordinates for d1cf7a_:

Click to download the PDB-style file with coordinates for d1cf7a_.
(The format of our PDB-style files is described here.)

Timeline for d1cf7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cf7b_