Lineage for d1cf7b_ (1cf7 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693355Family a.4.5.17: Cell cycle transcription factor e2f-dp [46847] (2 proteins)
    heterodimer of two homologous chains
  6. 2693356Protein Cell cycle transcription factor DP-2 [88654] (1 species)
  7. 2693357Species Human (Homo sapiens) [TaxId:9606] [88655] (1 PDB entry)
  8. 2693358Domain d1cf7b_: 1cf7 B: [16152]
    Other proteins in same PDB: d1cf7a_
    protein/DNA complex

Details for d1cf7b_

PDB Entry: 1cf7 (more details), 2.6 Å

PDB Description: structural basis of dna recognition by the heterodimeric cell cycle transcription factor e2f-dp
PDB Compounds: (B:) protein (transcription factor dp-2)

SCOPe Domain Sequences for d1cf7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf7b_ a.4.5.17 (B:) Cell cycle transcription factor DP-2 {Human (Homo sapiens) [TaxId: 9606]}
gkglrhfsmkvcekvqrkgttsynevadelvseftnsnnhlaadsaydqknirrrvydal
nvlmamniiskekkeikwiglp

SCOPe Domain Coordinates for d1cf7b_:

Click to download the PDB-style file with coordinates for d1cf7b_.
(The format of our PDB-style files is described here.)

Timeline for d1cf7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cf7a_