SCOPe 2.08: Domain d2pnkf_: 2pnk F:

Lineage for d2pnkf_ (2pnk F:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.8: Uronate isomerase-like [75082] (2 proteins)
   contains all-alpha subdomain inserted after the first strand

6. Protein Uncharacterized protein BH0493 [159395] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [159396] (9 PDB entries)
   Uniprot Q9KFI6 1-423

8. Domain d2pnkf_: 2pnk F: [161506]
   Other proteins in same PDB: d2pnka2, d2pnkd2, d2pnkk3
   automated match to d2pnka1
   complexed with act, cl, fmt, gol, mpd, na, po4, unl

Details for d2pnkf_

PDB Entry: 2pnk, 2 Å

PDB Description: crystal structure of an uronate isomerase (bh0493) from bacillus halodurans c-125 at 2.00 a resolution

PDB Compounds: (F:) BH0493 protein

SCOPe Domain Sequences for d2pnkf_:

Sequence; same for both SEQRES and ATOM records:

>d2pnkf_ c.1.9.8 (F:) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]}
sinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtdv
sieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfak
ktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeqt
khrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgriir
dcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtml
srenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvleq
liykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgr

Timeline for d2pnkf_:

• d2pnkf_ first appeared in SCOPe 2.01
  
• d2pnkf_ appears in SCOPe 2.07