Lineage for d2pnkj_ (2pnk J:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833783Family c.1.9.8: Uronate isomerase-like [75082] (2 proteins)
    contains all-alpha subdomain inserted after the first strand
  6. 2833784Protein Uncharacterized protein BH0493 [159395] (1 species)
  7. 2833785Species Bacillus halodurans [TaxId:86665] [159396] (9 PDB entries)
    Uniprot Q9KFI6 1-423
  8. 2833850Domain d2pnkj_: 2pnk J: [149681]
    Other proteins in same PDB: d2pnka2, d2pnkd2, d2pnkk3
    automated match to d2pnka1
    complexed with act, cl, fmt, gol, mpd, na, po4, unl

Details for d2pnkj_

PDB Entry: 2pnk (more details), 2 Å

PDB Description: crystal structure of an uronate isomerase (bh0493) from bacillus halodurans c-125 at 2.00 a resolution
PDB Compounds: (J:) BH0493 protein

SCOPe Domain Sequences for d2pnkj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pnkj_ c.1.9.8 (J:) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]}
msinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtd
vsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfa
kktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeq
tkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgrii
rdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtm
lsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvle
qliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvts

SCOPe Domain Coordinates for d2pnkj_:

Click to download the PDB-style file with coordinates for d2pnkj_.
(The format of our PDB-style files is described here.)

Timeline for d2pnkj_: