![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.8: Uronate isomerase-like [75082] (2 proteins) contains all-alpha subdomain inserted after the first strand |
![]() | Protein Uncharacterized protein BH0493 [159395] (1 species) |
![]() | Species Bacillus halodurans [TaxId:86665] [159396] (9 PDB entries) Uniprot Q9KFI6 1-423 |
![]() | Domain d2pnkl_: 2pnk L: [149683] Other proteins in same PDB: d2pnka2, d2pnkd2, d2pnkk3 automated match to d2pnka1 complexed with act, cl, fmt, gol, mpd, na, po4, unl |
PDB Entry: 2pnk (more details), 2 Å
SCOPe Domain Sequences for d2pnkl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pnkl_ c.1.9.8 (L:) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]} sinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtdv sieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfak ktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeqt khrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgriir dcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtml srenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvleq liykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvtsv kv
Timeline for d2pnkl_: