PDB entry 2pnk

View 2pnk on RCSB PDB site
Description: crystal structure of an uronate isomerase (bh0493) from bacillus halodurans c-125 at 2.00 a resolution
Class: isomerase
Keywords: uronate isomerase, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, isomerase
Deposited on 2007-04-24, released 2007-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BH0493 protein
    Species: Bacillus halodurans [TaxId:272558]
    Gene: NP_241359.1, BH0493
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KFI6 (1-End)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (25)
      • modified residue (56)
      • modified residue (69)
      • modified residue (142)
      • modified residue (215)
      • modified residue (220)
      • modified residue (257-258)
      • modified residue (281)
      • modified residue (300)
      • modified residue (320)
      • modified residue (328)
      • modified residue (337)
      • modified residue (340)
      • modified residue (342)
      • modified residue (344)
    Domains in SCOPe 2.08: d2pnka1, d2pnka2
  • Chain 'B':
    Compound: BH0493 protein
    Species: Bacillus halodurans [TaxId:272558]
    Gene: NP_241359.1, BH0493
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KFI6 (1-End)
      • modified residue (1)
      • modified residue (25)
      • modified residue (56)
      • modified residue (69)
      • modified residue (142)
      • modified residue (215)
      • modified residue (220)
      • modified residue (257-258)
      • modified residue (281)
      • modified residue (300)
      • modified residue (320)
      • modified residue (328)
      • modified residue (337)
      • modified residue (340)
      • modified residue (342)
      • modified residue (344)
    Domains in SCOPe 2.08: d2pnkb_
  • Chain 'C':
    Compound: BH0493 protein
    Species: Bacillus halodurans [TaxId:272558]
    Gene: NP_241359.1, BH0493
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KFI6 (1-End)
      • modified residue (1)
      • modified residue (25)
      • modified residue (56)
      • modified residue (69)
      • modified residue (142)
      • modified residue (215)
      • modified residue (220)
      • modified residue (257-258)
      • modified residue (281)
      • modified residue (300)
      • modified residue (320)
      • modified residue (328)
      • modified residue (337)
      • modified residue (340)
      • modified residue (342)
      • modified residue (344)
    Domains in SCOPe 2.08: d2pnkc_
  • Chain 'D':
    Compound: BH0493 protein
    Species: Bacillus halodurans [TaxId:272558]
    Gene: NP_241359.1, BH0493
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KFI6 (1-End)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (25)
      • modified residue (56)
      • modified residue (69)
      • modified residue (142)
      • modified residue (215)
      • modified residue (220)
      • modified residue (257-258)
      • modified residue (281)
      • modified residue (300)
      • modified residue (320)
      • modified residue (328)
      • modified residue (337)
      • modified residue (340)
      • modified residue (342)
      • modified residue (344)
    Domains in SCOPe 2.08: d2pnkd1, d2pnkd2
  • Chain 'E':
    Compound: BH0493 protein
    Species: Bacillus halodurans [TaxId:272558]
    Gene: NP_241359.1, BH0493
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KFI6
      • modified residue (25)
      • modified residue (56)
      • modified residue (69)
      • modified residue (142)
      • modified residue (215)
      • modified residue (220)
      • modified residue (257-258)
      • modified residue (281)
      • modified residue (300)
      • modified residue (320)
      • modified residue (328)
      • modified residue (337)
      • modified residue (340)
      • modified residue (342)
      • modified residue (344)
    Domains in SCOPe 2.08: d2pnke_
  • Chain 'F':
    Compound: BH0493 protein
    Species: Bacillus halodurans [TaxId:272558]
    Gene: NP_241359.1, BH0493
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KFI6
      • modified residue (25)
      • modified residue (56)
      • modified residue (69)
      • modified residue (142)
      • modified residue (215)
      • modified residue (220)
      • modified residue (257-258)
      • modified residue (281)
      • modified residue (300)
      • modified residue (320)
      • modified residue (328)
      • modified residue (337)
      • modified residue (340)
      • modified residue (342)
      • modified residue (344)
    Domains in SCOPe 2.08: d2pnkf_
  • Chain 'G':
    Compound: BH0493 protein
    Species: Bacillus halodurans [TaxId:272558]
    Gene: NP_241359.1, BH0493
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KFI6 (1-End)
      • modified residue (1)
      • modified residue (25)
      • modified residue (56)
      • modified residue (69)
      • modified residue (142)
      • modified residue (215)
      • modified residue (220)
      • modified residue (257-258)
      • modified residue (281)
      • modified residue (300)
      • modified residue (320)
      • modified residue (328)
      • modified residue (337)
      • modified residue (340)
      • modified residue (342)
      • modified residue (344)
    Domains in SCOPe 2.08: d2pnkg_
  • Chain 'H':
    Compound: BH0493 protein
    Species: Bacillus halodurans [TaxId:272558]
    Gene: NP_241359.1, BH0493
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KFI6 (1-End)
      • modified residue (1)
      • modified residue (25)
      • modified residue (56)
      • modified residue (69)
      • modified residue (142)
      • modified residue (215)
      • modified residue (220)
      • modified residue (257-258)
      • modified residue (281)
      • modified residue (300)
      • modified residue (320)
      • modified residue (328)
      • modified residue (337)
      • modified residue (340)
      • modified residue (342)
      • modified residue (344)
    Domains in SCOPe 2.08: d2pnkh_
  • Chain 'I':
    Compound: BH0493 protein
    Species: Bacillus halodurans [TaxId:272558]
    Gene: NP_241359.1, BH0493
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KFI6
      • modified residue (25)
      • modified residue (56)
      • modified residue (69)
      • modified residue (142)
      • modified residue (215)
      • modified residue (220)
      • modified residue (257-258)
      • modified residue (281)
      • modified residue (300)
      • modified residue (320)
      • modified residue (328)
      • modified residue (337)
      • modified residue (340)
      • modified residue (342)
      • modified residue (344)
    Domains in SCOPe 2.08: d2pnki_
  • Chain 'J':
    Compound: BH0493 protein
    Species: Bacillus halodurans [TaxId:272558]
    Gene: NP_241359.1, BH0493
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KFI6 (1-End)
      • modified residue (1)
      • modified residue (25)
      • modified residue (56)
      • modified residue (69)
      • modified residue (142)
      • modified residue (215)
      • modified residue (220)
      • modified residue (257-258)
      • modified residue (281)
      • modified residue (300)
      • modified residue (320)
      • modified residue (328)
      • modified residue (337)
      • modified residue (340)
      • modified residue (342)
      • modified residue (344)
    Domains in SCOPe 2.08: d2pnkj_
  • Chain 'K':
    Compound: BH0493 protein
    Species: Bacillus halodurans [TaxId:272558]
    Gene: NP_241359.1, BH0493
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KFI6 (1-End)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (25)
      • modified residue (56)
      • modified residue (69)
      • modified residue (142)
      • modified residue (215)
      • modified residue (220)
      • modified residue (257-258)
      • modified residue (281)
      • modified residue (300)
      • modified residue (320)
      • modified residue (328)
      • modified residue (337)
      • modified residue (340)
      • modified residue (342)
      • modified residue (344)
    Domains in SCOPe 2.08: d2pnkk2, d2pnkk3
  • Chain 'L':
    Compound: BH0493 protein
    Species: Bacillus halodurans [TaxId:272558]
    Gene: NP_241359.1, BH0493
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KFI6
      • modified residue (25)
      • modified residue (56)
      • modified residue (69)
      • modified residue (142)
      • modified residue (215)
      • modified residue (220)
      • modified residue (257-258)
      • modified residue (281)
      • modified residue (300)
      • modified residue (320)
      • modified residue (328)
      • modified residue (337)
      • modified residue (340)
      • modified residue (342)
      • modified residue (344)
    Domains in SCOPe 2.08: d2pnkl_
  • Heterogens: NA, CL, FMT, GOL, UNL, PO4, MPD, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pnkA (A:)
    gmsinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwt
    dvsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyf
    akktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneye
    qtkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgri
    irdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvt
    mlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvl
    eqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvt
    svkveqqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnkA (A:)
    gmsinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwt
    dvsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyf
    akktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneye
    qtkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgri
    irdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvt
    mlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvl
    eqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvt
    svkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pnkB (B:)
    gmsinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwt
    dvsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyf
    akktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneye
    qtkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgri
    irdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvt
    mlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvl
    eqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvt
    svkveqqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnkB (B:)
    msinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtd
    vsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfa
    kktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeq
    tkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgrii
    rdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtm
    lsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvle
    qliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvts
    vkv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pnkC (C:)
    gmsinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwt
    dvsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyf
    akktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneye
    qtkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgri
    irdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvt
    mlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvl
    eqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvt
    svkveqqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnkC (C:)
    msinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtd
    vsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfa
    kktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeq
    tkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgrii
    rdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtm
    lsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvle
    qliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvts
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pnkD (D:)
    gmsinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwt
    dvsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyf
    akktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneye
    qtkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgri
    irdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvt
    mlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvl
    eqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvt
    svkveqqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnkD (D:)
    gmsinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwt
    dvsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyf
    akktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneye
    qtkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgri
    irdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvt
    mlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvl
    eqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2pnkE (E:)
    gmsinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwt
    dvsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyf
    akktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneye
    qtkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgri
    irdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvt
    mlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvl
    eqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvt
    svkveqqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnkE (E:)
    insrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtdvs
    ieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfakk
    tseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeqtk
    hrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgriird
    cllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtmls
    renqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvleql
    iykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvts
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2pnkF (F:)
    gmsinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwt
    dvsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyf
    akktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneye
    qtkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgri
    irdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvt
    mlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvl
    eqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvt
    svkveqqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnkF (F:)
    sinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtdv
    sieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfak
    ktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeqt
    khrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgriir
    dcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtml
    srenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvleq
    liykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2pnkG (G:)
    gmsinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwt
    dvsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyf
    akktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneye
    qtkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgri
    irdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvt
    mlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvl
    eqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvt
    svkveqqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnkG (G:)
    msinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtd
    vsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfa
    kktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeq
    tkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgrii
    rdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtm
    lsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvle
    qliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvts
    vkv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2pnkH (H:)
    gmsinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwt
    dvsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyf
    akktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneye
    qtkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgri
    irdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvt
    mlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvl
    eqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvt
    svkveqqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnkH (H:)
    msinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtd
    vsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfa
    kktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeq
    tkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgrii
    rdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtm
    lsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvle
    qliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvts
    v
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2pnkI (I:)
    gmsinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwt
    dvsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyf
    akktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneye
    qtkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgri
    irdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvt
    mlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvl
    eqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvt
    svkveqqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnkI (I:)
    nsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtdvsi
    eafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfakkt
    seeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeqtkh
    rlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgriirdc
    llpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtmlsr
    enqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvleqli
    ykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvtsvkv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2pnkJ (J:)
    gmsinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwt
    dvsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyf
    akktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneye
    qtkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgri
    irdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvt
    mlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvl
    eqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvt
    svkveqqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnkJ (J:)
    msinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtd
    vsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfa
    kktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeq
    tkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgrii
    rdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtm
    lsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvle
    qliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvts
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2pnkK (K:)
    gmsinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwt
    dvsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyf
    akktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneye
    qtkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgri
    irdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvt
    mlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvl
    eqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvt
    svkveqqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnkK (K:)
    gmsinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwt
    dvsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyf
    akktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneye
    qtkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgri
    irdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvt
    mlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvl
    eqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvt
    svkv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2pnkL (L:)
    gmsinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwt
    dvsieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyf
    akktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneye
    qtkhrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgri
    irdcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvt
    mlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvl
    eqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvt
    svkveqqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnkL (L:)
    sinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtdv
    sieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfak
    ktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeqt
    khrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgriir
    dcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtml
    srenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvleq
    liykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgrndhvtsv
    kv