Lineage for d1foka2 (1fok A:144-281)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1519Family a.4.5.12: Restriction endonuclease FokI, N-terminal (recognition) domain [46824] (1 protein)
  6. 1520Protein Restriction endonuclease FokI, N-terminal (recognition) domain [46825] (1 species)
  7. 1521Species Flavobacterium okeanokoites [TaxId:244] [46826] (2 PDB entries)
  8. 1529Domain d1foka2: 1fok A:144-281 [16138]
    Other proteins in same PDB: d1foka4

Details for d1foka2

PDB Entry: 1fok (more details), 2.8 Å

PDB Description: structure of restriction endonuclease foki bound to dna

SCOP Domain Sequences for d1foka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1foka2 a.4.5.12 (A:144-281) Restriction endonuclease FokI, N-terminal (recognition) domain {Flavobacterium okeanokoites}
gsaiekeilieaissyppairiltlledgqhltkfdlgknlgfsgesgftslpegilldt
lanampkdkgeirnnwegssdkyarmiggwldklglvkqgkkefiiptpdnkefishafk
itgeglkvlrrakgs

SCOP Domain Coordinates for d1foka2:

Click to download the PDB-style file with coordinates for d1foka2.
(The format of our PDB-style files is described here.)

Timeline for d1foka2: