Lineage for d1foka4 (1fok A:387-579)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24772Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 24773Superfamily c.52.1: Restriction endonuclease-like [52980] (17 families) (S)
  5. 24901Family c.52.1.12: Restriction endonuclease FokI, C-terminal (catalytic) domain [53014] (1 protein)
  6. 24902Protein Restriction endonuclease FokI, C-terminal (catalytic) domain [53015] (1 species)
  7. 24903Species Flavobacterium okeanokoites [TaxId:244] [53016] (2 PDB entries)
  8. 24906Domain d1foka4: 1fok A:387-579 [33325]
    Other proteins in same PDB: d1foka1, d1foka2, d1foka3

Details for d1foka4

PDB Entry: 1fok (more details), 2.8 Å

PDB Description: structure of restriction endonuclease foki bound to dna

SCOP Domain Sequences for d1foka4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1foka4 c.52.1.12 (A:387-579) Restriction endonuclease FokI, C-terminal (catalytic) domain {Flavobacterium okeanokoites}
kseleekkselrhklkyvpheyielieiarnstqdrilemkvmeffmkvygyrgkhlggs
rkpdgaiytvgspidygvivdtkaysggynlpigqademqryveenqtrnkhinpnewwk
vypssvtefkflfvsghfkgnykaqltrlnhitncngavlsveelliggemikagtltle
evrrkfnngeinf

SCOP Domain Coordinates for d1foka4:

Click to download the PDB-style file with coordinates for d1foka4.
(The format of our PDB-style files is described here.)

Timeline for d1foka4: