Lineage for d1fnna1 (1fnn A:277-388)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1079364Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1079599Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins)
    follows the extended AAA-ATPase domain
  6. 1079600Protein CDC6, C-terminal domain [46822] (1 species)
    contains the N- and C-terminal helical extensions to the common fold
  7. 1079601Species Pyrobaculum aerophilum [TaxId:13773] [46823] (1 PDB entry)
  8. 1079602Domain d1fnna1: 1fnn A:277-388 [16129]
    Other proteins in same PDB: d1fnna2, d1fnnb2
    complexed with adp, mg

Details for d1fnna1

PDB Entry: 1fnn (more details), 2 Å

PDB Description: crystal structure of cdc6p from pyrobaculum aerophilum
PDB Compounds: (A:) cell division control protein 6

SCOPe Domain Sequences for d1fnna1:

Sequence, based on SEQRES records: (download)

>d1fnna1 a.4.5.11 (A:277-388) CDC6, C-terminal domain {Pyrobaculum aerophilum [TaxId: 13773]}
iseevliglplheklfllaivrslkishtpyitfgdaeesykivceeygerprvhsqlws
ylndlrekgivetrqnkrgegvrgrttlisigtepldtleavitklikeelr

Sequence, based on observed residues (ATOM records): (download)

>d1fnna1 a.4.5.11 (A:277-388) CDC6, C-terminal domain {Pyrobaculum aerophilum [TaxId: 13773]}
iseevliglplheklfllaivrslkishtpyitfgdaeesykivceeygerprvhsqlws
ylndlrekgivetrqnttlisigtepldtleavitklikeelr

SCOPe Domain Coordinates for d1fnna1:

Click to download the PDB-style file with coordinates for d1fnna1.
(The format of our PDB-style files is described here.)

Timeline for d1fnna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fnna2