SCOPe 2.02: Domain d1fnnb2: 1fnn B:1-276

Lineage for d1fnnb2 (1fnn B:1-276)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein CDC6, N-domain [52715] (1 species)
   contains "winged helix" DNA-binding domain after the family specific domains

7. Species Pyrobaculum aerophilum [TaxId:13773] [52716] (1 PDB entry)

8. Domain d1fnnb2: 1fnn B:1-276 [32427]
   Other proteins in same PDB: d1fnna1, d1fnnb1
   complexed with adp, mg

Details for d1fnnb2

PDB Entry: 1fnn, 2 Å

PDB Description: crystal structure of cdc6p from pyrobaculum aerophilum

PDB Compounds: (B:) cell division control protein 6

SCOPe Domain Sequences for d1fnnb2:

Sequence; same for both SEQRES and ATOM records:

>d1fnnb2 c.37.1.20 (B:1-276) CDC6, N-domain {Pyrobaculum aerophilum [TaxId: 13773]}
aivvddsvfspsyvpkrlphreqqlqqldillgnwlrnpghhypratllgrpgtgktvtl
rklwelykdkttarfvyingfiyrnftaiigeiarslnipfprrglsrdeflallvehlr
erdlymflvlddafnlapdilstfirlgqeadklgafrialvivghndavlnnldpstrg
imgkyvirfspytkdqifdilldrakaglaegsysedilqmiaditgaqtpldtnrgdar
laidilyrsayaaqqngrkhiapedvrksskevlfg

Timeline for d1fnnb2:

• d1fnnb2 first appeared (with stable ids) in SCOP 1.55
  
• d1fnnb2 appears in SCOPe 2.01
  
• d1fnnb2 appears in SCOPe 2.03
  
• d1fnnb2 appears in the current release, SCOPe 2.08