Lineage for d1fnna1 (1fnn A:277-388)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1510Family a.4.5.11: Helicase DNA-binding domain [46819] (2 proteins)
  6. 1511Protein CDC6, C-terminal domain [46822] (1 species)
  7. 1512Species Archaebacteria (Pyrobaculum aerophilum) [TaxId:13773] [46823] (1 PDB entry)
  8. 1513Domain d1fnna1: 1fnn A:277-388 [16129]
    Other proteins in same PDB: d1fnna2, d1fnnb2

Details for d1fnna1

PDB Entry: 1fnn (more details), 2 Å

PDB Description: crystal structure of cdc6p from pyrobaculum aerophilum

SCOP Domain Sequences for d1fnna1:

Sequence, based on SEQRES records: (download)

>d1fnna1 a.4.5.11 (A:277-388) CDC6, C-terminal domain {Archaebacteria (Pyrobaculum aerophilum)}
iseevliglplheklfllaivrslkishtpyitfgdaeesykivceeygerprvhsqlws
ylndlrekgivetrqnkrgegvrgrttlisigtepldtleavitklikeelr

Sequence, based on observed residues (ATOM records): (download)

>d1fnna1 a.4.5.11 (A:277-388) CDC6, C-terminal domain {Archaebacteria (Pyrobaculum aerophilum)}
iseevliglplheklfllaivrslkishtpyitfgdaeesykivceeygerprvhsqlws
ylndlrekgivetrqnttlisigtepldtleavitklikeelr

SCOP Domain Coordinates for d1fnna1:

Click to download the PDB-style file with coordinates for d1fnna1.
(The format of our PDB-style files is described here.)

Timeline for d1fnna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fnna2