![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins) follows the extended AAA-ATPase domain |
![]() | Protein CDC6, C-terminal domain [46822] (1 species) contains the N- and C-terminal helical extensions to the common fold |
![]() | Species Pyrobaculum aerophilum [TaxId:13773] [46823] (1 PDB entry) |
![]() | Domain d1fnna1: 1fnn A:277-388 [16129] Other proteins in same PDB: d1fnna2, d1fnnb2 complexed with adp, mg |
PDB Entry: 1fnn (more details), 2 Å
SCOPe Domain Sequences for d1fnna1:
Sequence, based on SEQRES records: (download)
>d1fnna1 a.4.5.11 (A:277-388) CDC6, C-terminal domain {Pyrobaculum aerophilum [TaxId: 13773]} iseevliglplheklfllaivrslkishtpyitfgdaeesykivceeygerprvhsqlws ylndlrekgivetrqnkrgegvrgrttlisigtepldtleavitklikeelr
>d1fnna1 a.4.5.11 (A:277-388) CDC6, C-terminal domain {Pyrobaculum aerophilum [TaxId: 13773]} iseevliglplheklfllaivrslkishtpyitfgdaeesykivceeygerprvhsqlws ylndlrekgivetrqnttlisigtepldtleavitklikeelr
Timeline for d1fnna1: