SCOPe 2.08: Domain d1fnna1: 1fnn A:277-388

Lineage for d1fnna1 (1fnn A:277-388)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins)
   follows the extended AAA-ATPase domain

6. Protein CDC6, C-terminal domain [46822] (1 species)
   contains the N- and C-terminal helical extensions to the common fold

7. Species Pyrobaculum aerophilum [TaxId:13773] [46823] (1 PDB entry)

8. Domain d1fnna1: 1fnn A:277-388 [16129]
   Other proteins in same PDB: d1fnna2, d1fnnb2
   complexed with adp, mg

Details for d1fnna1

PDB Entry: 1fnn, 2 Å

PDB Description: crystal structure of cdc6p from pyrobaculum aerophilum

PDB Compounds: (A:) cell division control protein 6

SCOPe Domain Sequences for d1fnna1:

Sequence, based on SEQRES records:

>d1fnna1 a.4.5.11 (A:277-388) CDC6, C-terminal domain {Pyrobaculum aerophilum [TaxId: 13773]}
iseevliglplheklfllaivrslkishtpyitfgdaeesykivceeygerprvhsqlws
ylndlrekgivetrqnkrgegvrgrttlisigtepldtleavitklikeelr

Sequence, based on observed residues (ATOM records):

>d1fnna1 a.4.5.11 (A:277-388) CDC6, C-terminal domain {Pyrobaculum aerophilum [TaxId: 13773]}
iseevliglplheklfllaivrslkishtpyitfgdaeesykivceeygerprvhsqlws
ylndlrekgivetrqnttlisigtepldtleavitklikeelr

Timeline for d1fnna1:

• d1fnna1 first appeared (with stable ids) in SCOP 1.55
  
• d1fnna1 appears in SCOPe 2.07