Lineage for d1runa1 (1run A:138-209)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1454Family a.4.5.4: CAP C-terminal domain-like [46796] (2 protein domains)
  6. 1455Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
  7. 1456Species Escherichia coli [TaxId:562] [46798] (7 PDB entries)
  8. 1466Domain d1runa1: 1run A:138-209 [16103]
    Other proteins in same PDB: d1runa2, d1runb2

Details for d1runa1

PDB Entry: 1run (more details), 2.7 Å

PDB Description: catabolite gene activator protein (cap)/dna complex + adenosine-3',5'-cyclic-monophosphate

SCOP Domain Sequences for d1runa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1runa1 a.4.5.4 (A:138-209) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvygtr

SCOP Domain Coordinates for d1runa1:

Click to download the PDB-style file with coordinates for d1runa1.
(The format of our PDB-style files is described here.)

Timeline for d1runa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1runa2