| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins) |
| Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species) N-terminal domain has double beta-helix fold |
| Species Escherichia coli [TaxId:562] [46798] (28 PDB entries) |
| Domain d1runa1: 1run A:138-209 [16103] Other proteins in same PDB: d1runa2, d1runb2 protein/DNA complex; complexed with cmp |
PDB Entry: 1run (more details), 2.7 Å
SCOPe Domain Sequences for d1runa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1runa1 a.4.5.4 (A:138-209) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvygtr
Timeline for d1runa1: