Lineage for d1ignb2 (1ign B:446-594)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692173Family a.4.1.6: DNA-binding domain of rap1 [46753] (3 proteins)
    duplication: consist of two domains of this fold
  6. Protein DNA-binding domain of rap1, C-terminal domain [418895] (1 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419295] (1 PDB entry)
  8. 2692177Domain d1ignb2: 1ign B:446-594 [16051]
    Other proteins in same PDB: d1igna1, d1ignb1
    protein/DNA complex

Details for d1ignb2

PDB Entry: 1ign (more details), 2.25 Å

PDB Description: dna-binding domain of rap1 in complex with telomeric dna site
PDB Compounds: (B:) protein (rap1)

SCOPe Domain Sequences for d1ignb2:

Sequence, based on SEQRES records: (download)

>d1ignb2 a.4.1.6 (B:446-594) DNA-binding domain of rap1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
krkfsadedytlaiavkkqfyrdlfqidpdtgrslitdedtptaiarrnmtmdpnhvpgs
epnfaayrtqsrrgpiareffkhfaeehaahtenawrdrfrkfllaygiddyisyyeaek
aqnrepepmknltnrpkrpgvptpgnyns

Sequence, based on observed residues (ATOM records): (download)

>d1ignb2 a.4.1.6 (B:446-594) DNA-binding domain of rap1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
krkfsadedytlaiavkkqfyrdlfqidpdtgrslirtqsrrgpiareffkhfaeehaah
tenawrdrfrkfllaygiddyisyyeaeepmknltptpgnyns

SCOPe Domain Coordinates for d1ignb2:

Click to download the PDB-style file with coordinates for d1ignb2.
(The format of our PDB-style files is described here.)

Timeline for d1ignb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ignb1