![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.6: DNA-binding domain of rap1 [46753] (3 proteins) duplication: consist of two domains of this fold |
![]() | Protein DNA-binding domain of rap1, N-terminal domain [418894] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419294] (1 PDB entry) |
![]() | Domain d1ignb1: 1ign B:360-445 [16050] Other proteins in same PDB: d1igna2, d1ignb2 protein/DNA complex has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ign (more details), 2.25 Å
SCOPe Domain Sequences for d1ignb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ignb1 a.4.1.6 (B:360-445) DNA-binding domain of rap1, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kasftdeedefildvvrknptrrtthtlydeishyvpnhtgnsirhrfrvylskrleyvy evdkfgklvrdddgnliktkvlppsi
Timeline for d1ignb1: