Lineage for d1tc3c_ (1tc3 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691999Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)
  6. 2692032Protein Transposase tc3a1-65 [46733] (1 species)
  7. 2692033Species Nematode (Caenorhabditis elegans) [TaxId:6239] [46734] (2 PDB entries)
    Uniprot P34257 2-104
  8. 2692034Domain d1tc3c_: 1tc3 C: [16025]
    protein/DNA complex

Details for d1tc3c_

PDB Entry: 1tc3 (more details), 2.45 Å

PDB Description: transposase tc3a1-65 from caenorhabditis elegans
PDB Compounds: (C:) protein (tc3 transposase)

SCOPe Domain Sequences for d1tc3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tc3c_ a.4.1.2 (C:) Transposase tc3a1-65 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
prgsalsdteraqldvmkllnvslhemsrkisrsrhcirvylkdpvsygts

SCOPe Domain Coordinates for d1tc3c_:

Click to download the PDB-style file with coordinates for d1tc3c_.
(The format of our PDB-style files is described here.)

Timeline for d1tc3c_: