PDB entry 1tc3

View 1tc3 on RCSB PDB site
Description: transposase tc3a1-65 from caenorhabditis elegans
Class: DNA binding protein/DNA
Keywords: transposase, DNA binding, helix-turn-helix, tc1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex
Deposited on 1997-07-07, released 1997-11-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.234
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA (5'-d(*ap*gp*gp*gp*gp*gp*gp*gp*tp*cp*cp*tp*ap*tp*ap*gp*a p*ap*cp*tp*t)-3')
  
• Chain 'B':
  Compound: DNA (5'-d(*ap*gp*tp*tp*cp*tp*ap*tp*ap*gp*gp*ap*cp*cp*cp*cp*c p*cp*cp*t)-3')
  
• Chain 'C':
  Compound: protein (tc3 transposase)
  Species: Caenorhabditis elegans [TaxId:6239]
  Gene: TC3A
  Database cross-references and differences (RAF-indexed):
  • Uniprot P34257 (0-50)
    • conflict (39)
  Domains in SCOPe 2.08: d1tc3c_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tc3C (C:)
  prgsalsdteraqldvmkllnvslhemsrkisrsrhcirvylkdpvsygts