SCOP 1.71: Domain d1cqtb1: 1cqt B:602-661

Lineage for d1cqtb1 (1cqt B:602-661)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (13 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (28 proteins)
   Pfam 00046

6. Protein Oct-1 POU Homeodomain [46699] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46700] (7 PDB entries)

8. Domain d1cqtb1: 1cqt B:602-661 [15993]
   Other proteins in same PDB: d1cqta2, d1cqtb2

Details for d1cqtb1

PDB Entry: 1cqt, 3.2 Å

PDB Description: crystal structure of a ternary complex containing an oca-b peptide, the oct-1 pou domain, and an octamer element

SCOP Domain Sequences for d1cqtb1:

Sequence, based on SEQRES records:

>d1cqtb1 a.4.1.1 (B:602-661) Oct-1 POU Homeodomain {Human (Homo sapiens)}
rkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfcnrrqkekrinp

Sequence, based on observed residues (ATOM records):

>d1cqtb1 a.4.1.1 (B:602-661) Oct-1 POU Homeodomain {Human (Homo sapiens)}
rkkrtsietnirvaleksflenqktseeitmiadqlnmekevirvwfcnrrqkekrinp

Timeline for d1cqtb1:

• d1cqtb1 first appeared (with stable ids) in SCOP 1.55
  
• d1cqtb1 appears in SCOP 1.69
  
• d1cqtb1 appears in SCOP 1.73
  
• d1cqtb1 appears in the current release, SCOPe 2.08