PDB entry 1cqt

View 1cqt on RCSB PDB site
Description: crystal structure of a ternary complex containing an oca-b peptide, the oct-1 pou domain, and an octamer element
Deposited on 1999-08-11, released 1999-11-15
The last revision prior to the SCOP 1.71 freeze date was dated 1999-11-15, with a file datestamp of 1999-11-14.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.264
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cqtA (A:)
    gsreepsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsf
    knmcklkpllekwlndaenlssdsslsspsalnspgieglsrrrkkrtsietnirvalek
    sflenqkptseeitmiadqlnmekevirvwfcnrrqkekrinp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cqtA (A:)
    epsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmc
    klkpllekwlndaerkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirv
    wfcnrrqkekrinp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cqtB (B:)
    gsreepsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsf
    knmcklkpllekwlndaenlssdsslsspsalnspgieglsrrrkkrtsietnirvalek
    sflenqkptseeitmiadqlnmekevirvwfcnrrqkekrinp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cqtB (B:)
    dleeleqfaktfkqrriklgftqgdvglamgklyndfsqttisrfealnlsfknmcklkp
    llekwlndaerkkrtsietnirvaleksflenqktseeitmiadqlnmekevirvwfcnr
    rqkekrinp