Lineage for d1cqtb1 (1cqt B:602-661)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691904Protein Oct-1 POU Homeodomain [46699] (1 species)
  7. 2691905Species Human (Homo sapiens) [TaxId:9606] [46700] (7 PDB entries)
  8. 2691912Domain d1cqtb1: 1cqt B:602-661 [15993]
    Other proteins in same PDB: d1cqta2, d1cqtb2
    protein/DNA complex

Details for d1cqtb1

PDB Entry: 1cqt (more details), 3.2 Å

PDB Description: crystal structure of a ternary complex containing an oca-b peptide, the oct-1 pou domain, and an octamer element
PDB Compounds: (B:) pou domain, class 2, transcription factor 1

SCOPe Domain Sequences for d1cqtb1:

Sequence, based on SEQRES records: (download)

>d1cqtb1 a.4.1.1 (B:602-661) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]}
rkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfcnrrqkekrinp

Sequence, based on observed residues (ATOM records): (download)

>d1cqtb1 a.4.1.1 (B:602-661) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]}
rkkrtsietnirvaleksflenqktseeitmiadqlnmekevirvwfcnrrqkekrinp

SCOPe Domain Coordinates for d1cqtb1:

Click to download the PDB-style file with coordinates for d1cqtb1.
(The format of our PDB-style files is described here.)

Timeline for d1cqtb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cqtb2