![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (13 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (28 proteins) Pfam 00046 |
![]() | Protein Oct-1 POU Homeodomain [46699] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46700] (7 PDB entries) |
![]() | Domain d1cqta1: 1cqt A:102-161 [15992] Other proteins in same PDB: d1cqta2, d1cqtb2 |
PDB Entry: 1cqt (more details), 3.2 Å
SCOP Domain Sequences for d1cqta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqta1 a.4.1.1 (A:102-161) Oct-1 POU Homeodomain {Human (Homo sapiens)} rkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfcnrrqkekrinp
Timeline for d1cqta1: