Lineage for d1hddc_ (1hdd C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691791Protein Engrailed Homeodomain [46691] (1 species)
  7. 2691792Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46692] (12 PDB entries)
  8. 2691812Domain d1hddc_: 1hdd C: [15978]
    protein/DNA complex

Details for d1hddc_

PDB Entry: 1hdd (more details), 2.8 Å

PDB Description: crystal structure of an engrailed homeodomain-dna complex at 2.8 angstroms resolution: a framework for understanding homeodomain-dna interactions
PDB Compounds: (C:) protein (engrailed homeodomain)

SCOPe Domain Sequences for d1hddc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hddc_ a.4.1.1 (C:) Engrailed Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnkrakikks

SCOPe Domain Coordinates for d1hddc_:

Click to download the PDB-style file with coordinates for d1hddc_.
(The format of our PDB-style files is described here.)

Timeline for d1hddc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hddd_