Lineage for d2mtac_ (2mta C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690878Protein Cytochrome c551 [46660] (5 species)
  7. 2690881Species Paracoccus denitrificans [TaxId:266] [46663] (5 PDB entries)
  8. 2690898Domain d2mtac_: 2mta C: [15908]
    Other proteins in same PDB: d2mtaa_, d2mtah_, d2mtal_
    complexed with cu, hec, po4

Details for d2mtac_

PDB Entry: 2mta (more details), 2.4 Å

PDB Description: crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
PDB Compounds: (C:) cytochrome c551i

SCOPe Domain Sequences for d2mtac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mtac_ a.3.1.1 (C:) Cytochrome c551 {Paracoccus denitrificans [TaxId: 266]}
apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
rhlytgdpkdaswltdeqkagftpfqp

SCOPe Domain Coordinates for d2mtac_:

Click to download the PDB-style file with coordinates for d2mtac_.
(The format of our PDB-style files is described here.)

Timeline for d2mtac_: