Class a: All alpha proteins [46456] (290 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Cytochrome c551 [46660] (5 species) |
Species Paracoccus denitrificans [TaxId:266] [46663] (5 PDB entries) |
Domain d2mtac_: 2mta C: [15908] Other proteins in same PDB: d2mtaa_, d2mtah_, d2mtal_ complexed with cu, hec, po4 |
PDB Entry: 2mta (more details), 2.4 Å
SCOPe Domain Sequences for d2mtac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mtac_ a.3.1.1 (C:) Cytochrome c551 {Paracoccus denitrificans [TaxId: 266]} apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv rhlytgdpkdaswltdeqkagftpfqp
Timeline for d2mtac_: