Lineage for d2mtal_ (2mta L:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2585672Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 2585673Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 2585674Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 protein domains)
    automatically mapped to Pfam PF02975
  6. 2585675Protein Methylamine dehydrogenase [57563] (2 species)
  7. 2585676Species Paracoccus denitrificans [TaxId:266] [57564] (24 PDB entries)
  8. 2585707Domain d2mtal_: 2mta L: [44884]
    Other proteins in same PDB: d2mtaa_, d2mtac_, d2mtah_
    complexed with cu, hem, po4

Details for d2mtal_

PDB Entry: 2mta (more details), 2.4 Å

PDB Description: crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
PDB Compounds: (L:) methylamine dehydrogenase (light subunit)

SCOPe Domain Sequences for d2mtal_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mtal_ g.21.1.1 (L:) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d2mtal_:

Click to download the PDB-style file with coordinates for d2mtal_.
(The format of our PDB-style files is described here.)

Timeline for d2mtal_: