Lineage for d2mtac_ (2mta C:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins) 
Protein Cytochrome c551 [46660] (4 species) 
Species Paracoccus denitrificans [TaxId:266] [46663] (1 PDB entry) 
Domain d2mtac_: 2mta C: [15908]
Other proteins in same PDB: d2mtaa_, d2mtah_, d2mtal_
Details for d2mtac_
PDB Entry: 2mta (more details), 2.4 Å
PDB Description: crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
SCOP Domain Sequences for d2mtac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mtac_ a.3.1.1 (C:) Cytochrome c551 {Paracoccus denitrificans}
apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
rhlytgdpkdaswltdeqkagftpfqp
SCOP Domain Coordinates for d2mtac_:
Click to download the PDB-style file with coordinates for d2mtac_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2mtac_:
- d2mtac_ appears in SCOP 1.57
- d2mtac_ appears in the current release, SCOPe 2.08
View in 3D
