SCOPe 2.08: Domain d1ccha_: 1cch A:

Lineage for d1ccha_ (1cch A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c551 [46660] (5 species)

7. Species Pseudomonas stutzeri [TaxId:316] [46661] (3 PDB entries)

8. Domain d1ccha_: 1cch A: [15902]
   complexed with hec

Details for d1ccha_

PDB Entry: 1cch

PDB Description: the solution conformation of cytochrome c-551 from p.stutzeri zobell determined by nmr+

PDB Compounds: (A:) cytochrome c551

SCOPe Domain Sequences for d1ccha_:

Sequence; same for both SEQRES and ATOM records:

>d1ccha_ a.3.1.1 (A:) Cytochrome c551 {Pseudomonas stutzeri [TaxId: 316]}
qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalhikngsqgvwgpip
mppnpvteeeakilaewvlslk

Timeline for d1ccha_:

• d1ccha_ first appeared (with stable ids) in SCOP 1.55, called d1cch__
  
• d1ccha_ appears in SCOPe 2.07