![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Cytochrome c551 [46660] (5 species) |
![]() | Species Pseudomonas stutzeri [TaxId:316] [46661] (3 PDB entries) |
![]() | Domain d1ccha_: 1cch A: [15902] complexed with hec |
PDB Entry: 1cch (more details)
SCOPe Domain Sequences for d1ccha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ccha_ a.3.1.1 (A:) Cytochrome c551 {Pseudomonas stutzeri [TaxId: 316]} qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalhikngsqgvwgpip mppnpvteeeakilaewvlslk
Timeline for d1ccha_: