Lineage for d1ccha_ (1cch A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304334Protein Cytochrome c551 [46660] (5 species)
  7. 2304365Species Pseudomonas stutzeri [TaxId:316] [46661] (3 PDB entries)
  8. 2304368Domain d1ccha_: 1cch A: [15902]
    complexed with hem

Details for d1ccha_

PDB Entry: 1cch (more details)

PDB Description: the solution conformation of cytochrome c-551 from p.stutzeri zobell determined by nmr+
PDB Compounds: (A:) cytochrome c551

SCOPe Domain Sequences for d1ccha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ccha_ a.3.1.1 (A:) Cytochrome c551 {Pseudomonas stutzeri [TaxId: 316]}
qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalhikngsqgvwgpip
mppnpvteeeakilaewvlslk

SCOPe Domain Coordinates for d1ccha_:

Click to download the PDB-style file with coordinates for d1ccha_.
(The format of our PDB-style files is described here.)

Timeline for d1ccha_: