PDB entry 1cch

View 1cch on RCSB PDB site
Description: the solution conformation of cytochrome c-551 from p.stutzeri zobell determined by nmr+
Class: electron transport
Keywords: electron transport
Deposited on 1994-02-25, released 1994-04-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-10, with a file datestamp of 2021-03-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c551
    Species: Pseudomonas stutzeri [TaxId:316]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ccha_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cchA (A:)
    qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalhikngsqgvwgpip
    mppnpvteeeakilaewvlslk