SCOPe 2.08: Domain d1cota_: 1cot A:

Lineage for d1cota_ (1cot A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c2 [46650] (8 species)

7. Species Paracoccus denitrificans [TaxId:266] [46657] (2 PDB entries)

8. Domain d1cota_: 1cot A: [15899]
   complexed with hec

Details for d1cota_

PDB Entry: 1cot, 1.7 Å

PDB Description: x-ray structure of the cytochrome c2 isolated from paracoccus denitrificans refined to 1.7 angstroms resolution

PDB Compounds: (A:) cytochrome c2

SCOPe Domain Sequences for d1cota_:

Sequence; same for both SEQRES and ATOM records:

>d1cota_ a.3.1.1 (A:) Cytochrome c2 {Paracoccus denitrificans [TaxId: 266]}
dgdaakgekefnkckachmiqapdgtdiikggktgpnlygvvgrkiaseegfkygegile
vaeknpdltwteadlieyvtdpkpwlvkmtddkgaktkmtfkmgknqadvvaflaqnspd
a

Timeline for d1cota_:

• d1cota_ first appeared (with stable ids) in SCOP 1.55, called d1cot__
  
• d1cota_ appears in SCOPe 2.07