PDB entry 1cot

View 1cot on RCSB PDB site
Description: x-ray structure of the cytochrome c2 isolated from paracoccus denitrificans refined to 1.7 angstroms resolution
Class: electron transport
Keywords: electron transport
Deposited on 1994-07-06, released 1994-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c2
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cota_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cotA (A:)
    qdgdaakgekefnkckachmiqapdgtdiikggktgpnlygvvgrkiaseegfkygegil
    evaeknpdltwteadlieyvtdpkpwlvkmtddkgaktkmtfkmgknqadvvaflaqnsp
    daggdgeaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cotA (A:)
    dgdaakgekefnkckachmiqapdgtdiikggktgpnlygvvgrkiaseegfkygegile
    vaeknpdltwteadlieyvtdpkpwlvkmtddkgaktkmtfkmgknqadvvaflaqnspd
    a