Lineage for d1cot__ (1cot -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins) 
Protein Cytochrome c2 [46650] (7 species) 
Species Paracoccus denitrificans [TaxId:266] [46657] (2 PDB entries) 
Domain d1cot__: 1cot - [15899]
Details for d1cot__
PDB Entry: 1cot (more details), 1.7 Å
PDB Description: x-ray structure of the cytochrome c2 isolated from paracoccus denitrificans refined to 1.7 angstroms resolution
SCOP Domain Sequences for d1cot__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cot__ a.3.1.1 (-) Cytochrome c2 {Paracoccus denitrificans}
dgdaakgekefnkckachmiqapdgtdiikggktgpnlygvvgrkiaseegfkygegile
vaeknpdltwteadlieyvtdpkpwlvkmtddkgaktkmtfkmgknqadvvaflaqnspd
a
SCOP Domain Coordinates for d1cot__:
Click to download the PDB-style file with coordinates for d1cot__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cot__:
- d1cot__ appears in SCOP 1.57
- d1cot__ appears in the current release, SCOPe 2.08, called d1cota_
View in 3D