![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Mitochondrial cytochrome c [46642] (7 species) |
![]() | Species Rice embryos (Oryza sativa) [TaxId:4530] [46645] (1 PDB entry) |
![]() | Domain d1ccra_: 1ccr A: [15877] complexed with hec |
PDB Entry: 1ccr (more details), 1.5 Å
SCOPe Domain Sequences for d1ccra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ccra_ a.3.1.1 (A:) Mitochondrial cytochrome c {Rice embryos (Oryza sativa) [TaxId: 4530]} asfseappgnpkagekifktkcaqchtvdkgaghkqgpnlnglfgrqsgttpgysystad knmaviweentlydyllnpkkyipgtkmvfpglkkpqeradlisylkeats
Timeline for d1ccra_: