PDB entry 1ccr

View 1ccr on RCSB PDB site
Description: structure of rice ferricytochrome c at 2.0 angstroms resolution
Class: electron transport(cytochrome)
Keywords: electron transport(cytochrome)
Deposited on 1983-03-14, released 1983-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c
  Species: Oryza sativa [TaxId:4530]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00055 (0-110)
    • conflict (59)
  Domains in SCOPe 2.08: d1ccra_
• Heterogens: HEC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ccrA (A:)
  asfseappgnpkagekifktkcaqchtvdkgaghkqgpnlnglfgrqsgttpgysystad
  knmaviweentlydyllnpkkyipgtkmvfpglkkpqeradlisylkeats