SCOPe 2.08: Domain d1yeba_: 1yeb A:

Lineage for d1yeba_ (1yeb A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (92 PDB entries)
   Uniprot P00044

8. Domain d1yeba_: 1yeb A: [15843]
   complexed with hec, so4; mutant

Details for d1yeba_

PDB Entry: 1yeb, 1.95 Å

PDB Description: structure determination and analysis of yeast iso-2-cytochrome c and a composite mutant protein

PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d1yeba_:

Sequence; same for both SEQRES and ATOM records:

>d1yeba_ a.3.1.1 (A:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrcqqchtieeggpnkvgpnlhgifgrhsgqvkgysytdanink
nvkwdedsmseyltnpkkyipgtkmafgglkkekdrndlitylkkace

Timeline for d1yeba_:

• d1yeba_ first appeared (with stable ids) in SCOP 1.55, called d1yeb__
  
• d1yeba_ appears in SCOPe 2.07